Interactive SALAD analysis

The SALAD analysis output can be obtained interactively with anonymous fasta file given by user.

If you want to analyze other sequence lists other than SALAD ver.1 dataset (rice, Arabidopsis thaliana, red algae), please try this intaractive SALAD analysis.

All of SALAD data were created for each annotation group. A motif is a sequence pattern that occurs repeatedly in a group of related prote in sequences. Therefore, discovering motifs may be different in different groups . To avoid a mistake and get new insight, you had better refer to some result ab out the same annotation. SALAD database has function of intaractive SALAD analys is, please try it.

Go to Submission Form

TOP

BACK

Analysis procedure

1. Prepare sequence file(Fasta format).

  *Note(Limitation)
    • Upload file must be lower 1MB in size.
    • Number of Sequence must be more than two and less than 120.

Fasta format (e.g.,

> Os01g02414xx
MQGARSAAAMAAAAADEEREVRRAVEEKPVV
GDDADPAALVDAALQARRRKDGGDKAAAGDG
> At3g0234x
MAPVSLPPGFRFHPTDEELITYYLKRKINGQ
DRKYPNGSRTNRATKGGYWKATGKDRRVSWR

• Sequences in FASTA formatted files are preceded by a line starting with a " >" symbol.

2. Fill in items, then click Upload button.

3. You get our e-mail immediately after the end of analysis, and then you can access your result.

E-mail notification service(example)

SALAD job confirmation;

 Your SALAD job is finished.
 Query ID; RzTFdjcOjd 

 http://salad.dna.affrc.go.jxxxxxx.jsp?pfamid=RzTFdjcOjd

Result of analysis

TOP